PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn066061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 445aa    MW: 48699.8 Da    PI: 8.6476
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn066061genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like924.9e-29180233155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr++W+ eLH++Fv av+qL G+ekA+Pk++l+lm+v+gLt+e+v+SHLQkYRl
  Achn066061 180 KPRVVWSIELHRKFVAAVNQL-GIEKAVPKRVLDLMNVEGLTRENVASHLQKYRL 233
                 79*******************.********************************8 PP

2Response_reg65.23.1e-221510421109
                   TTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
  Response_reg  21 egyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                   +++ +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll++   e  +lp+i+++a+++++++ + +  Ga d+l+Kp+ +eel++
    Achn066061  15 DRFPVVTSTSQAKTALRMLRENQnrFDLVISDVHMPDMDGFKLLEHVGLEM-DLPVIMLSANSDPKLVMKGITHGACDYLVKPVRIEELRN 104
                   567799*************888888**********************6644.8************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004483.4E-181106IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011035.2281110IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.2E-1915105IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521721.21E-2618117IPR011006CheY-like superfamily
CDDcd001561.67E-2319110No hitNo description
Gene3DG3DSA:3.40.50.23004.0E-3220129No hitNo description
PROSITE profilePS5129411.535177236IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-30177238IPR009057Homeodomain-like
SuperFamilySSF466892.69E-19177237IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-24180233IPR006447Myb domain, plants
PfamPF002495.8E-6182232IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MTVEEIRGRL GGETDRFPVV TSTSQAKTAL RMLRENQNRF DLVISDVHMP DMDGFKLLEH  60
VGLEMDLPVI MLSANSDPKL VMKGITHGAC DYLVKPVRIE ELRNIWQHVI RRKKCEAKHE  120
SKSTTKGKNR HGNGEGEQGP SPTDNMDQNG KINRKRKDDE EEEDGEENGS ENEDTGTQKK  180
PRVVWSIELH RKFVAAVNQL GIEKAVPKRV LDLMNVEGLT RENVASHLQK YRLYLKRISS  240
VATQQANMVA ALGGTDSSYM RSLSSLDGFG DFRTLAGQGR YPNPALSSYQ TGGIFGRLNS  300
PAGVSLHSLS SSALIQPSHA HNLSNSLNTL EKFQPVVLPE KQNTSSFQRI PTSLEFDSPG  360
DPTIFTSVGN ASLFADNRAP LGISSNSLPS ASVNPLILQG NLQQMQSGGV FGNQSSLKVG  420
SLNSKPFNTE GTVQISRFSS NSLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-25178239364ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343681.10.0PREDICTED: two-component response regulator ORR24-like
SwissprotA2X1N21e-121ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A068UNX60.0A0A068UNX6_COFCA; Uncharacterized protein
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22582458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-106response regulator 12